Lineage for d1tfqa1 (1tfq A:241-356)

  1. Root: SCOPe 2.07
  2. 2581248Class g: Small proteins [56992] (98 folds)
  3. 2589070Fold g.52: Inhibitor of apoptosis (IAP) repeat [57923] (1 superfamily)
    metal(zinc)-bound alpha+beta fold
  4. 2589071Superfamily g.52.1: Inhibitor of apoptosis (IAP) repeat [57924] (2 families) (S)
  5. 2589072Family g.52.1.1: Inhibitor of apoptosis (IAP) repeat [57925] (7 proteins)
  6. 2589127Protein BIR domains of XIAP [57928] (1 species)
  7. 2589128Species Human (Homo sapiens) [TaxId:9606] [57929] (15 PDB entries)
    Uniprot P98170 241-356
  8. 2589160Domain d1tfqa1: 1tfq A:241-356 [106858]
    Other proteins in same PDB: d1tfqa2
    complexed with 998, zn

Details for d1tfqa1

PDB Entry: 1tfq (more details)

PDB Description: NMR Structure of an Antagonists of the XIAP-Caspase-9 Interaction Complexed to the BIR3 domain of XIAP
PDB Compounds: (A:) baculoviral iap repeat-containing protein 4

SCOPe Domain Sequences for d1tfqa1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1tfqa1 g.52.1.1 (A:241-356) BIR domains of XIAP {Human (Homo sapiens) [TaxId: 9606]}
sdavssdrnfpnstnlprnpsmadyeariftfgtwiysvnkeqlaragfyalgegdkvkc
fhcgggltdwkpsedpweqhakwypgckylleqkgqeyinnihlthsleeclvrtt

SCOPe Domain Coordinates for d1tfqa1:

Click to download the PDB-style file with coordinates for d1tfqa1.
(The format of our PDB-style files is described here.)

Timeline for d1tfqa1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1tfqa2