SCOPe 2.08: Domain d1tfqa1: 1tfq A:241-356

Lineage for d1tfqa1 (1tfq A:241-356)

1. Root: SCOPe 2.08

2. Class g: Small proteins [56992] (100 folds)

3. Fold g.52: Inhibitor of apoptosis (IAP) repeat [57923] (1 superfamily)
   metal(zinc)-bound alpha+beta fold

4. Superfamily g.52.1: Inhibitor of apoptosis (IAP) repeat [57924] (2 families)

5. Family g.52.1.1: Inhibitor of apoptosis (IAP) repeat [57925] (7 proteins)

6. Protein BIR domains of XIAP [57928] (1 species)

7. Species Human (Homo sapiens) [TaxId:9606] [57929] (15 PDB entries)
   Uniprot P98170 241-356

8. Domain d1tfqa1: 1tfq A:241-356 [106858]
   Other proteins in same PDB: d1tfqa2
   complexed with 998, zn
   has additional insertions and/or extensions that are not grouped together

Details for d1tfqa1

PDB Entry: 1tfq

PDB Description: nmr structure of an antagonists of the xiap-caspase-9 interaction complexed to the bir3 domain of xiap

PDB Compounds: (A:) baculoviral iap repeat-containing protein 4

SCOPe Domain Sequences for d1tfqa1:

Sequence; same for both SEQRES and ATOM records:

>d1tfqa1 g.52.1.1 (A:241-356) BIR domains of XIAP {Human (Homo sapiens) [TaxId: 9606]}
sdavssdrnfpnstnlprnpsmadyeariftfgtwiysvnkeqlaragfyalgegdkvkc
fhcgggltdwkpsedpweqhakwypgckylleqkgqeyinnihlthsleeclvrtt

Timeline for d1tfqa1:

• d1tfqa1 first appeared in SCOP 1.69, called d1tfqa_
  
• d1tfqa1 appears in SCOPe 2.07