![]() | Class b: All beta proteins [48724] (165 folds) |
![]() | Fold b.42: beta-Trefoil [50352] (8 superfamilies) barrel, closed; n=6, S=12; and a hairpin triplet; meander duplication: has internal pseudo threefold symmetry |
![]() | Superfamily b.42.2: Ricin B-like lectins [50370] (3 families) ![]() |
![]() | Family b.42.2.1: Ricin B-like [50371] (7 proteins) |
![]() | Protein Plant cytotoxin B-chain (lectin) [50372] (5 species) duplication: consists of two domains of this fold |
![]() | Species European mistletoe (Viscum album) [TaxId:3972] [50375] (11 PDB entries) different sequence variants |
![]() | Domain d1tfmb2: 1tfm B:134-255 [106857] Other proteins in same PDB: d1tfma_ complexed with bgc, bma, glb, nag, p6c |
PDB Entry: 1tfm (more details), 2.8 Å
SCOP Domain Sequences for d1tfmb2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1tfmb2 b.42.2.1 (B:134-255) Plant cytotoxin B-chain (lectin) {European mistletoe (Viscum album) [TaxId: 3972]} taprevtiygfndlcmesnggsvwvetcvsqqndrwalygdgsirpeqnqdqcltsgrds vaginivscsggssgqrwvftnegailnlknglamdvanpglgqiiiypatgkpnqmwlp vp
Timeline for d1tfmb2: