Lineage for d1tfmb2 (1tfm B:134-255)

  1. Root: SCOP 1.69
  2. 450777Class b: All beta proteins [48724] (144 folds)
  3. 464258Fold b.42: beta-Trefoil [50352] (8 superfamilies)
    barrel, closed; n=6, S=12; and a hairpin triplet; meander
    duplication: has internal pseudo threefold symmetry
  4. 464433Superfamily b.42.2: Ricin B-like lectins [50370] (2 families) (S)
  5. 464434Family b.42.2.1: Ricin B-like [50371] (6 proteins)
  6. 464453Protein Plant cytotoxin B-chain (lectin) [50372] (5 species)
    duplication: consists of two domains of this fold
  7. 464460Species European mistletoe (Viscum album) [TaxId:3972] [50375] (9 PDB entries)
    different sequence variants
  8. 464472Domain d1tfmb2: 1tfm B:134-255 [106857]
    Other proteins in same PDB: d1tfma_

Details for d1tfmb2

PDB Entry: 1tfm (more details), 2.8 Å

PDB Description: crystal structure of a ribosome inactivating protein in its naturally inhibited form

SCOP Domain Sequences for d1tfmb2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1tfmb2 b.42.2.1 (B:134-255) Plant cytotoxin B-chain (lectin) {European mistletoe (Viscum album)}
taprevtiygfndlcmesnggsvwvetcvsqqndrwalygdgsirpeqnqdqcltsgrds
vaginivscsggssgqrwvftnegailnlknglamdvanpglgqiiiypatgkpnqmwlp
vp

SCOP Domain Coordinates for d1tfmb2:

Click to download the PDB-style file with coordinates for d1tfmb2.
(The format of our PDB-style files is described here.)

Timeline for d1tfmb2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1tfmb1
View in 3D
Domains from other chains:
(mouse over for more information)
d1tfma_