SCOP 1.71: Domain d1tfmb1: 1tfm B:1-133

Lineage for d1tfmb1 (1tfm B:1-133)

1. Root: SCOP 1.71

2. Class b: All beta proteins [48724] (149 folds)

3. Fold b.42: beta-Trefoil [50352] (8 superfamilies)
   barrel, closed; n=6, S=12; and a hairpin triplet; meander
   duplication: has internal pseudo threefold symmetry

4. Superfamily b.42.2: Ricin B-like lectins [50370] (3 families)

5. Family b.42.2.1: Ricin B-like [50371] (7 proteins)

6. Protein Plant cytotoxin B-chain (lectin) [50372] (5 species)
   duplication: consists of two domains of this fold

7. Species European mistletoe (Viscum album) [TaxId:3972] [50375] (10 PDB entries)
   different sequence variants

8. Domain d1tfmb1: 1tfm B:1-133 [106856]
   Other proteins in same PDB: d1tfma_

Details for d1tfmb1

PDB Entry: 1tfm, 2.8 Å

PDB Description: crystal structure of a ribosome inactivating protein in its naturally inhibited form

SCOP Domain Sequences for d1tfmb1:

Sequence; same for both SEQRES and ATOM records:

>d1tfmb1 b.42.2.1 (B:1-133) Plant cytotoxin B-chain (lectin) {European mistletoe (Viscum album)}
csaseptvrivgrngmnvdvrdddfhdgnqiqlwpsksnndpnqlwtikrdgtirsngsc
lttygytagvyvmifdcntavreatiwqiwgngtiinprsnlalaassgikgttltvqtl
dytlgqgwlagnd

Timeline for d1tfmb1:

• d1tfmb1 first appeared in SCOP 1.69
  
• d1tfmb1 appears in SCOP 1.73
  
• d1tfmb1 appears in the current release, SCOPe 2.08