SCOPe 2.07: Domain d1tfma_: 1tfm A:

Lineage for d1tfma_ (1tfm A:)

1. Root: SCOPe 2.07

2. Class d: Alpha and beta proteins (a+b) [53931] (388 folds)

3. Fold d.165: Ribosome inactivating proteins (RIP) [56370] (1 superfamily)
   contains mixed beta-sheet

4. Superfamily d.165.1: Ribosome inactivating proteins (RIP) [56371] (3 families)

5. Family d.165.1.1: Plant cytotoxins [56372] (18 proteins)

6. Protein Mistletoe lectin I A-chain [56381] (1 species)

7. Species European mistletoe (Viscum album) [TaxId:3972] [56382] (12 PDB entries)
   different sequence variants
   Uniprot P81446 1-249
   Uniprot Q6ITZ3 1-240

8. Domain d1tfma_: 1tfm A: [106855]
   Other proteins in same PDB: d1tfmb1, d1tfmb2
   complexed with gal, nag, p6c

Details for d1tfma_

PDB Entry: 1tfm, 2.8 Å

PDB Description: crystal structure of a ribosome inactivating protein in its naturally inhibited form

PDB Compounds: (A:) Himalayan mistletoe ribosome-inactivating protein

SCOPe Domain Sequences for d1tfma_:

Sequence; same for both SEQRES and ATOM records:

>d1tfma_ d.165.1.1 (A:) Mistletoe lectin I A-chain {European mistletoe (Viscum album) [TaxId: 3972]}
yerldldvtsqttgeeyfrfitllrdyvssgsfsneipllrqsgggveaarfvlveltne
ggdsitaaidvtnlyvvayqagsqsyflsgpgthlftgttrsslpfngsypdleqyaghr
kqiplgidqliqsvtalrfpgntrtqarsililiqmiseaarfnpilwrarqyinsgasf
lpdvymleletswgqqstqvqqstegvfnnpirlaipgnfvtltnvrdviaslaimlfvc

Timeline for d1tfma_:

• d1tfma_ first appeared in SCOP 1.69
  
• d1tfma_ appears in SCOPe 2.06
  
• d1tfma_ appears in the current release, SCOPe 2.08