![]() | Class d: Alpha and beta proteins (a+b) [53931] (286 folds) |
![]() | Fold d.165: Ribosome inactivating proteins (RIP) [56370] (1 superfamily) contains mixed beta-sheet |
![]() | Superfamily d.165.1: Ribosome inactivating proteins (RIP) [56371] (2 families) ![]() |
![]() | Family d.165.1.1: Plant cytotoxins [56372] (15 proteins) |
![]() | Protein Mistletoe lectin I A-chain [56381] (1 species) |
![]() | Species European mistletoe (Viscum album) [TaxId:3972] [56382] (10 PDB entries) different sequence variants |
![]() | Domain d1tfma_: 1tfm A: [106855] Other proteins in same PDB: d1tfmb1, d1tfmb2 complexed with bgc, bma, glb, nag, p6c |
PDB Entry: 1tfm (more details), 2.8 Å
SCOP Domain Sequences for d1tfma_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1tfma_ d.165.1.1 (A:) Mistletoe lectin I A-chain {European mistletoe (Viscum album)} yerldldvtsqttgeeyfrfitllrdyvssgsfsneipllrqsgggveaarfvlveltne ggdsitaaidvtnlyvvayqagsqsyflsgpgthlftgttrsslpfngsypdleqyaghr kqiplgidqliqsvtalrfpgntrtqarsililiqmiseaarfnpilwrarqyinsgasf lpdvymleletswgqqstqvqqstegvfnnpirlaipgnfvtltnvrdviaslaimlfvc
Timeline for d1tfma_: