Lineage for d1tfcb_ (1tfc B:)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2728284Fold a.123: Nuclear receptor ligand-binding domain [48507] (1 superfamily)
    multihelical; 3 layers or orthogonally packed helices
  4. 2728285Superfamily a.123.1: Nuclear receptor ligand-binding domain [48508] (2 families) (S)
  5. 2728286Family a.123.1.1: Nuclear receptor ligand-binding domain [48509] (34 proteins)
  6. 2728740Protein Orphan nuclear receptor ERR3 [81916] (1 species)
  7. 2728741Species Human (Homo sapiens) [TaxId:9606] [81917] (24 PDB entries)
    Uniprot O75454 233-458
  8. 2728764Domain d1tfcb_: 1tfc B: [106851]
    Other proteins in same PDB: d1tfcc_, d1tfcd1, d1tfcd2

Details for d1tfcb_

PDB Entry: 1tfc (more details), 2.4 Å

PDB Description: crystal structure of the ligand-binding domain of the estrogen-related receptor gamma in complex with a steroid receptor coactivator-1 peptide
PDB Compounds: (B:) Estrogen-related receptor gamma

SCOPe Domain Sequences for d1tfcb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1tfcb_ a.123.1.1 (B:) Orphan nuclear receptor ERR3 {Human (Homo sapiens) [TaxId: 9606]}
pynkivshllvaepekiyampdptvpdsdikalttlcdladrelvviigwakhipgfstl
sladqmsllqsawmeililgvvyrslsfedelvyaddyimdedqsklaglldlnnailql
vkkyksmklekeefvtlkaialansdsmhiedveavqklqdvlhealqdyeagqhmedpr
ragkmlmtlpllrqtstkavqhfyniklegkvpmhklflemleak

SCOPe Domain Coordinates for d1tfcb_:

Click to download the PDB-style file with coordinates for d1tfcb_.
(The format of our PDB-style files is described here.)

Timeline for d1tfcb_: