Class c: Alpha and beta proteins (a/b) [51349] (136 folds) |
Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily) 3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes |
Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (22 families) division into families based on beta-sheet topologies |
Family c.37.1.11: RecA protein-like (ATPase-domain) [52670] (14 proteins) core: mixed beta-sheet of 8 strands, order 32451678; strand 7 is antiparallel to the rest |
Protein Circadian clock protein KaiC [110558] (1 species) duplication: contains two copies of this domain |
Species Synechococcus sp. strain PCC 7942 (Anacystis nidulans R2) [TaxId:1140] [110559] (1 PDB entry) |
Domain d1tf7c2: 1tf7 C:256-497 [106843] |
PDB Entry: 1tf7 (more details), 2.8 Å
SCOP Domain Sequences for d1tf7c2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1tf7c2 c.37.1.11 (C:256-497) Circadian clock protein KaiC {Synechococcus sp. strain PCC 7942 (Anacystis nidulans R2)} qrssnvrvssgvvrldemcgggffkdsiilatgatgtgktllvsrfvenacankerailf ayeesraqllrnayswgmdfeemerqnllkivcaypesagledhlqiikseindfkpari aidslsalargvsnnafrqfvigvtgyakqeeitglftntsdqfmgahsitdshistitd tiillqyveirgemsrainvfkmrgswhdkairefmisdkgpdikdsfrnferiisgspt ri
Timeline for d1tf7c2: