Lineage for d1tf7c2 (1tf7 C:256-497)

  1. Root: SCOP 1.69
  2. 473232Class c: Alpha and beta proteins (a/b) [51349] (136 folds)
  3. 483669Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
    3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes
  4. 483670Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (22 families) (S)
    division into families based on beta-sheet topologies
  5. 484903Family c.37.1.11: RecA protein-like (ATPase-domain) [52670] (14 proteins)
    core: mixed beta-sheet of 8 strands, order 32451678; strand 7 is antiparallel to the rest
  6. 485046Protein Circadian clock protein KaiC [110558] (1 species)
    duplication: contains two copies of this domain
  7. 485047Species Synechococcus sp. strain PCC 7942 (Anacystis nidulans R2) [TaxId:1140] [110559] (1 PDB entry)
  8. 485053Domain d1tf7c2: 1tf7 C:256-497 [106843]

Details for d1tf7c2

PDB Entry: 1tf7 (more details), 2.8 Å

PDB Description: Crystal Structure of Circadian Clock Protein KaiC

SCOP Domain Sequences for d1tf7c2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1tf7c2 c.37.1.11 (C:256-497) Circadian clock protein KaiC {Synechococcus sp. strain PCC 7942 (Anacystis nidulans R2)}
qrssnvrvssgvvrldemcgggffkdsiilatgatgtgktllvsrfvenacankerailf
ayeesraqllrnayswgmdfeemerqnllkivcaypesagledhlqiikseindfkpari
aidslsalargvsnnafrqfvigvtgyakqeeitglftntsdqfmgahsitdshistitd
tiillqyveirgemsrainvfkmrgswhdkairefmisdkgpdikdsfrnferiisgspt
ri

SCOP Domain Coordinates for d1tf7c2:

Click to download the PDB-style file with coordinates for d1tf7c2.
(The format of our PDB-style files is described here.)

Timeline for d1tf7c2: