Class a: All alpha proteins [46456] (289 folds) |
Fold a.162: Pre-protein crosslinking domain of SecA [81766] (1 superfamily) core: 4 helices: bundle; flanked by two short beta-hairpins duplication: consists of two structural repeats |
Superfamily a.162.1: Pre-protein crosslinking domain of SecA [81767] (1 family) automatically mapped to Pfam PF01043 |
Family a.162.1.1: Pre-protein crosslinking domain of SecA [81768] (1 protein) |
Protein Pre-protein crosslinking domain of SecA [81769] (3 species) |
Species Bacillus subtilis [TaxId:1423] [81770] (4 PDB entries) Uniprot P28366 |
Domain d1tf5a1: 1tf5 A:227-348 [106834] Other proteins in same PDB: d1tf5a2, d1tf5a3, d1tf5a4, d1tf5a5 |
PDB Entry: 1tf5 (more details), 2.18 Å
SCOPe Domain Sequences for d1tf5a1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1tf5a1 a.162.1.1 (A:227-348) Pre-protein crosslinking domain of SecA {Bacillus subtilis [TaxId: 1423]} aakstklyvqanafvrtlkaekdytydiktkavqlteegmtkaekafgidnlfdvkhval nhhinqalkahvamqkdvdyvvedgqvvivdsftgrlmkgrryseglhqaieakegleiq ne
Timeline for d1tf5a1:
View in 3D Domains from same chain: (mouse over for more information) d1tf5a2, d1tf5a3, d1tf5a4, d1tf5a5 |