Lineage for d1tf2a4 (1tf2 A:396-570)

  1. Root: SCOPe 2.07
  2. 2434694Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2473887Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
    3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes
  4. 2473888Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (26 families) (S)
    division into families based on beta-sheet topologies
  5. 2478770Family c.37.1.19: Tandem AAA-ATPase domain [81268] (27 proteins)
    duplication: tandem repeat of two RecA-like (AAA) domains
  6. 2478971Protein Translocation ATPase SecA, nucleotide-binding domains [82414] (3 species)
    a pre-protein crosslinking domain inserted in the first AAA domain
  7. 2478972Species Bacillus subtilis [TaxId:1423] [82415] (4 PDB entries)
    Uniprot P28366
  8. 2478978Domain d1tf2a4: 1tf2 A:396-570 [106833]
    Other proteins in same PDB: d1tf2a1, d1tf2a2, d1tf2a5
    complexed with adp, mg

Details for d1tf2a4

PDB Entry: 1tf2 (more details), 2.9 Å

PDB Description: Crystal structure of SecA:ADP in an open conformation from Bacillus Subtilis
PDB Compounds: (A:) Preprotein translocase secA subunit

SCOPe Domain Sequences for d1tf2a4:

Sequence; same for both SEQRES and ATOM records: (download)

>d1tf2a4 c.37.1.19 (A:396-570) Translocation ATPase SecA, nucleotide-binding domains {Bacillus subtilis [TaxId: 1423]}
rpvvrddrpdliyrtmegkfkavaedvaqrymtgqpvlvgtvavetseliskllknkgip
hqvlnaknhereaqiieeagqkgavtiatnmagrgtdiklgegvkelgglavvgterhes
rridnqlrgrsgrqgdpgitqfylsmedelmrrfgaertmamldrfgmddstpiq

SCOPe Domain Coordinates for d1tf2a4:

Click to download the PDB-style file with coordinates for d1tf2a4.
(The format of our PDB-style files is described here.)

Timeline for d1tf2a4: