![]() | Class a: All alpha proteins [46456] (290 folds) |
![]() | Fold a.172: Helical scaffold and wing domains of SecA [81885] (1 superfamily) multihelical; consists of 2 all-alpha subdomains |
![]() | Superfamily a.172.1: Helical scaffold and wing domains of SecA [81886] (1 family) ![]() automatically mapped to Pfam PF07516 |
![]() | Family a.172.1.1: Helical scaffold and wing domains of SecA [81887] (1 protein) |
![]() | Protein Helical scaffold and wing domains of SecA [81888] (3 species) |
![]() | Species Bacillus subtilis [TaxId:1423] [81889] (4 PDB entries) Uniprot P28366 |
![]() | Domain d1tf2a2: 1tf2 A:571-780 [106831] Other proteins in same PDB: d1tf2a1, d1tf2a3, d1tf2a4, d1tf2a5 complexed with adp, mg |
PDB Entry: 1tf2 (more details), 2.9 Å
SCOPe Domain Sequences for d1tf2a2:
Sequence, based on SEQRES records: (download)
>d1tf2a2 a.172.1.1 (A:571-780) Helical scaffold and wing domains of SecA {Bacillus subtilis [TaxId: 1423]} skmvsravessqkrvegnnfdsrkqllqyddvlrqqreviykqrfevidsenlreivenm ikssleraiaaytpreelpeewkldglvdlinttyldegaleksdifgkepdemlelimd riitkynekeeqfgkeqmrefekvivlravdskwmdhidamdqlrqgihlrayaqtnplr eyqmegfamfehmiesiedevakfvmkaei
>d1tf2a2 a.172.1.1 (A:571-780) Helical scaffold and wing domains of SecA {Bacillus subtilis [TaxId: 1423]} skmvsravessqkrvegnnfdsrkqllqyddvlrqqreviykqrfevidsenlreivenm ikssleraiaaytpreeewkldglvdlinttyldegaleksdifgkepdemlelimdrii tkynekeeqfgkeqmrefekvivlravdskwmdhidamdqlrqgihlrayaqtnplreyq megfamfehmiesiedevakfvmkaei
Timeline for d1tf2a2:
![]() Domains from same chain: (mouse over for more information) d1tf2a1, d1tf2a3, d1tf2a4, d1tf2a5 |