SCOPe 2.05: Domain d1tf2a1: 1tf2 A:227-348

Lineage for d1tf2a1 (1tf2 A:227-348)

1. Root: SCOPe 2.05

2. Class a: All alpha proteins [46456] (286 folds)

3. Fold a.162: Pre-protein crosslinking domain of SecA [81766] (1 superfamily)
   core: 4 helices: bundle; flanked by two short beta-hairpins
   duplication: consists of two structural repeats

4. Superfamily a.162.1: Pre-protein crosslinking domain of SecA [81767] (1 family)
   automatically mapped to Pfam PF01043

5. Family a.162.1.1: Pre-protein crosslinking domain of SecA [81768] (1 protein)

6. Protein Pre-protein crosslinking domain of SecA [81769] (3 species)

7. Species Bacillus subtilis [TaxId:1423] [81770] (4 PDB entries)
   Uniprot P28366

8. Domain d1tf2a1: 1tf2 A:227-348 [106830]
   Other proteins in same PDB: d1tf2a2, d1tf2a3, d1tf2a4
   complexed with adp, mg

Details for d1tf2a1

PDB Entry: 1tf2, 2.9 Å

PDB Description: Crystal structure of SecA:ADP in an open conformation from Bacillus Subtilis

PDB Compounds: (A:) Preprotein translocase secA subunit

SCOPe Domain Sequences for d1tf2a1:

Sequence; same for both SEQRES and ATOM records:

>d1tf2a1 a.162.1.1 (A:227-348) Pre-protein crosslinking domain of SecA {Bacillus subtilis [TaxId: 1423]}
aakstklyvqanafvrtlkaekdytydiktkavqlteegmtkaekafgidnlfdvkhval
nhhinqalkahvamqkdvdyvvedgqvvivdsftgrlmkgrryseglhqaieakegleiq
ne

Timeline for d1tf2a1:

• d1tf2a1 first appeared in SCOP 1.69
  
• d1tf2a1 appears in SCOPe 2.04
  
• d1tf2a1 appears in SCOPe 2.06
  
• d1tf2a1 appears in the current release, SCOPe 2.08