Lineage for d1tf1d_ (1tf1 D:)

  1. Root: SCOP 1.71
  2. 595667Class d: Alpha and beta proteins (a+b) [53931] (286 folds)
  3. 609436Fold d.110: Profilin-like [55769] (7 superfamilies)
    core: 2 alpha-helices and 5-stranded antiparallel sheet: order 21543; 3 layers: alpha/beta/alpha
  4. 609478Superfamily d.110.2: GAF domain-like [55781] (3 families) (S)
    alpha(2)-beta(3)-alpha-beta(3)-alpha; antiparallel beta-sheet: order 321654
  5. 609492Family d.110.2.2: IclR ligand-binding domain-like [75513] (2 proteins)
    Pfam 01614
  6. 609493Protein Transcriptional regulator AllR, C-terminal domain [111113] (1 species)
  7. 609494Species Escherichia coli [TaxId:562] [111114] (1 PDB entry)
  8. 609498Domain d1tf1d_: 1tf1 D: [106829]
    Structural genomics target

Details for d1tf1d_

PDB Entry: 1tf1 (more details), 1.8 Å

PDB Description: crystal structure of the e. coli glyoxylate regulatory protein ligand binding domain

SCOP Domain Sequences for d1tf1d_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1tf1d_ d.110.2.2 (D:) Transcriptional regulator AllR, C-terminal domain {Escherichia coli}
grenlyfqghmdvlsvagpfmrrlmllsgetvnvairngneavligqlecksmvrmcapl
gsrlplhasgagkallyplaeeelmsiilqtglqqftpttlvdmptllkdleqarelgyt
vdkeehvvglnciasaiyddvgsvvaaisisgpssrltedrfvsqgelvrdtardistal
glk

SCOP Domain Coordinates for d1tf1d_:

Click to download the PDB-style file with coordinates for d1tf1d_.
(The format of our PDB-style files is described here.)

Timeline for d1tf1d_: