Class d: Alpha and beta proteins (a+b) [53931] (286 folds) |
Fold d.110: Profilin-like [55769] (7 superfamilies) core: 2 alpha-helices and 5-stranded antiparallel sheet: order 21543; 3 layers: alpha/beta/alpha |
Superfamily d.110.2: GAF domain-like [55781] (3 families) alpha(2)-beta(3)-alpha-beta(3)-alpha; antiparallel beta-sheet: order 321654 |
Family d.110.2.2: IclR ligand-binding domain-like [75513] (2 proteins) Pfam 01614 |
Protein Transcriptional regulator AllR, C-terminal domain [111113] (1 species) |
Species Escherichia coli [TaxId:562] [111114] (1 PDB entry) |
Domain d1tf1c_: 1tf1 C: [106828] |
PDB Entry: 1tf1 (more details), 1.8 Å
SCOP Domain Sequences for d1tf1c_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1tf1c_ d.110.2.2 (C:) Transcriptional regulator AllR, C-terminal domain {Escherichia coli} lyfqghmdvlsvagpfmrrlmllsgetvnvairngneavligqlecksmvrmcaplgsrl plhasgagkallyplaeeelmsiilqtglqqftpttlvdmptllkdleqarelgytvdke ehvvglnciasaiyddvgsvvaaisisgpssrltedrfvsqgelvrdtardistalglk
Timeline for d1tf1c_: