Lineage for d1tf1c_ (1tf1 C:)

  1. Root: SCOP 1.69
  2. 496776Class d: Alpha and beta proteins (a+b) [53931] (279 folds)
  3. 509664Fold d.110: Profilin-like [55769] (7 superfamilies)
    core: 2 alpha-helices and 5-stranded antiparallel sheet: order 21543; 3 layers: alpha/beta/alpha
  4. 509706Superfamily d.110.2: GAF domain-like [55781] (3 families) (S)
    alpha(2)-beta(3)-alpha-beta(3)-alpha; antiparallel beta-sheet: order 321654
  5. 509720Family d.110.2.2: IclR ligand-binding domain-like (Pfam 01614) [75513] (2 proteins)
  6. 509721Protein Transcriptional regulator AllR, C-terminal domain [111113] (1 species)
  7. 509722Species Escherichia coli [TaxId:562] [111114] (1 PDB entry)
  8. 509725Domain d1tf1c_: 1tf1 C: [106828]

Details for d1tf1c_

PDB Entry: 1tf1 (more details), 1.8 Å

PDB Description: crystal structure of the e. coli glyoxylate regulatory protein ligand binding domain

SCOP Domain Sequences for d1tf1c_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1tf1c_ d.110.2.2 (C:) Transcriptional regulator AllR, C-terminal domain {Escherichia coli}
lyfqghmdvlsvagpfmrrlmllsgetvnvairngneavligqlecksmvrmcaplgsrl
plhasgagkallyplaeeelmsiilqtglqqftpttlvdmptllkdleqarelgytvdke
ehvvglnciasaiyddvgsvvaaisisgpssrltedrfvsqgelvrdtardistalglk

SCOP Domain Coordinates for d1tf1c_:

Click to download the PDB-style file with coordinates for d1tf1c_.
(The format of our PDB-style files is described here.)

Timeline for d1tf1c_: