Lineage for d1tf1b_ (1tf1 B:)

  1. Root: SCOPe 2.05
  2. 1886641Class d: Alpha and beta proteins (a+b) [53931] (381 folds)
  3. 1922390Fold d.110: Profilin-like [55769] (10 superfamilies)
    core: 2 alpha-helices and 5-stranded antiparallel sheet: order 21543; 3 layers: alpha/beta/alpha
  4. 1922459Superfamily d.110.2: GAF domain-like [55781] (5 families) (S)
    alpha(2)-beta(3)-alpha-beta(3)-alpha; antiparallel beta-sheet: order 321654
  5. 1922525Family d.110.2.2: IclR ligand-binding domain-like [75513] (2 proteins)
    Pfam PF01614
  6. 1922526Protein Transcriptional regulator AllR, C-terminal domain [111113] (1 species)
  7. 1922527Species Escherichia coli [TaxId:562] [111114] (1 PDB entry)
    Uniprot P77734 97-269
  8. 1922529Domain d1tf1b_: 1tf1 B: [106827]
    Structural genomics target

Details for d1tf1b_

PDB Entry: 1tf1 (more details), 1.8 Å

PDB Description: crystal structure of the e. coli glyoxylate regulatory protein ligand binding domain
PDB Compounds: (B:) Negative regulator of allantoin and glyoxylate utilization operons

SCOPe Domain Sequences for d1tf1b_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1tf1b_ d.110.2.2 (B:) Transcriptional regulator AllR, C-terminal domain {Escherichia coli [TaxId: 562]}
yfqghmdvlsvagpfmrrlmllsgetvnvairngneavligqlecksmvrmcaplgsrlp
lhasgagkallyplaeeelmsiilqtglqqftpttlvdmptllkdleqarelgytvdkee
hvvglnciasaiyddvgsvvaaisisgpssrltedrfvsqgelvrdtardistalglk

SCOPe Domain Coordinates for d1tf1b_:

Click to download the PDB-style file with coordinates for d1tf1b_.
(The format of our PDB-style files is described here.)

Timeline for d1tf1b_: