SCOPe 2.05: Domain d1tf1b_: 1tf1 B:

Lineage for d1tf1b_ (1tf1 B:)

1. Root: SCOPe 2.05

2. Class d: Alpha and beta proteins (a+b) [53931] (381 folds)

3. Fold d.110: Profilin-like [55769] (10 superfamilies)
   core: 2 alpha-helices and 5-stranded antiparallel sheet: order 21543; 3 layers: alpha/beta/alpha

4. Superfamily d.110.2: GAF domain-like [55781] (5 families)
   alpha(2)-beta(3)-alpha-beta(3)-alpha; antiparallel beta-sheet: order 321654

5. Family d.110.2.2: IclR ligand-binding domain-like [75513] (2 proteins)
   Pfam PF01614

6. Protein Transcriptional regulator AllR, C-terminal domain [111113] (1 species)

7. Species Escherichia coli [TaxId:562] [111114] (1 PDB entry)
   Uniprot P77734 97-269

8. Domain d1tf1b_: 1tf1 B: [106827]
   Structural genomics target

Details for d1tf1b_

PDB Entry: 1tf1, 1.8 Å

PDB Description: crystal structure of the e. coli glyoxylate regulatory protein ligand binding domain

PDB Compounds: (B:) Negative regulator of allantoin and glyoxylate utilization operons

SCOPe Domain Sequences for d1tf1b_:

Sequence; same for both SEQRES and ATOM records:

>d1tf1b_ d.110.2.2 (B:) Transcriptional regulator AllR, C-terminal domain {Escherichia coli [TaxId: 562]}
yfqghmdvlsvagpfmrrlmllsgetvnvairngneavligqlecksmvrmcaplgsrlp
lhasgagkallyplaeeelmsiilqtglqqftpttlvdmptllkdleqarelgytvdkee
hvvglnciasaiyddvgsvvaaisisgpssrltedrfvsqgelvrdtardistalglk

Timeline for d1tf1b_:

• d1tf1b_ first appeared in SCOP 1.69
  
• d1tf1b_ appears in SCOPe 2.04
  
• d1tf1b_ is called d1tf1b1 in SCOPe 2.06
  
• d1tf1b_ appears in the current release, SCOPe 2.08, called d1tf1b1