![]() | Class d: Alpha and beta proteins (a+b) [53931] (279 folds) |
![]() | Fold d.110: Profilin-like [55769] (7 superfamilies) core: 2 alpha-helices and 5-stranded antiparallel sheet: order 21543; 3 layers: alpha/beta/alpha |
![]() | Superfamily d.110.2: GAF domain-like [55781] (3 families) ![]() alpha(2)-beta(3)-alpha-beta(3)-alpha; antiparallel beta-sheet: order 321654 |
![]() | Family d.110.2.2: IclR ligand-binding domain-like (Pfam 01614) [75513] (2 proteins) |
![]() | Protein Transcriptional regulator AllR, C-terminal domain [111113] (1 species) |
![]() | Species Escherichia coli [TaxId:562] [111114] (1 PDB entry) |
![]() | Domain d1tf1a_: 1tf1 A: [106826] |
PDB Entry: 1tf1 (more details), 1.8 Å
SCOP Domain Sequences for d1tf1a_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1tf1a_ d.110.2.2 (A:) Transcriptional regulator AllR, C-terminal domain {Escherichia coli} grenlyfqghmdvlsvagpfmrrlmllsgetvnvairngneavligqlecksmvrmcapl gsrlplhasgagkallyplaeeelmsiilqtglqqftpttlvdmptllkdleqarelgyt vdkeehvvglnciasaiyddvgsvvaaisisgpssrltedrfvsqgelvrdtardistal glka
Timeline for d1tf1a_: