SCOP 1.69: Domain d1tf1a_: 1tf1 A:

Lineage for d1tf1a_ (1tf1 A:)

1. Root: SCOP 1.69

2. Class d: Alpha and beta proteins (a+b) [53931] (279 folds)

3. Fold d.110: Profilin-like [55769] (7 superfamilies)
   core: 2 alpha-helices and 5-stranded antiparallel sheet: order 21543; 3 layers: alpha/beta/alpha

4. Superfamily d.110.2: GAF domain-like [55781] (3 families)
   alpha(2)-beta(3)-alpha-beta(3)-alpha; antiparallel beta-sheet: order 321654

5. Family d.110.2.2: IclR ligand-binding domain-like (Pfam 01614) [75513] (2 proteins)

6. Protein Transcriptional regulator AllR, C-terminal domain [111113] (1 species)

7. Species Escherichia coli [TaxId:562] [111114] (1 PDB entry)

8. Domain d1tf1a_: 1tf1 A: [106826]

Details for d1tf1a_

PDB Entry: 1tf1, 1.8 Å

PDB Description: crystal structure of the e. coli glyoxylate regulatory protein ligand binding domain

SCOP Domain Sequences for d1tf1a_:

Sequence; same for both SEQRES and ATOM records:

>d1tf1a_ d.110.2.2 (A:) Transcriptional regulator AllR, C-terminal domain {Escherichia coli}
grenlyfqghmdvlsvagpfmrrlmllsgetvnvairngneavligqlecksmvrmcapl
gsrlplhasgagkallyplaeeelmsiilqtglqqftpttlvdmptllkdleqarelgyt
vdkeehvvglnciasaiyddvgsvvaaisisgpssrltedrfvsqgelvrdtardistal
glka

Timeline for d1tf1a_:

• d1tf1a_ is new in SCOP 1.69
  
• d1tf1a_ appears in SCOP 1.71
  
• d1tf1a_ appears in the current release, SCOPe 2.08, called d1tf1a1