Class a: All alpha proteins [46456] (258 folds) |
Fold a.8: immunoglobulin/albumin-binding domain-like [46996] (10 superfamilies) 3 helices; bundle, closed, left-handed twist; up-and-down; mirror topology to the spectrin-like fold |
Superfamily a.8.1: Bacterial immunoglobulin/albumin-binding domains [46997] (2 families) |
Family a.8.1.2: GA module, an albumin-binding domain [47001] (3 proteins) Pfam PF01468; also includes FIVAR module, Pfam 07554 |
Protein PAB [47002] (1 species) |
Species Peptostreptococcus magnus [TaxId:1260] [47003] (3 PDB entries) |
Domain d1tf0b_: 1tf0 B: [106825] Other proteins in same PDB: d1tf0a1, d1tf0a2, d1tf0a3 complexed with cit, dka |
PDB Entry: 1tf0 (more details), 2.7 Å
SCOP Domain Sequences for d1tf0b_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1tf0b_ a.8.1.2 (B:) PAB {Peptostreptococcus magnus [TaxId: 1260]} tidqwllknakedaiaelkkagitsdfyfnainkaktveevnalkneilkaha
Timeline for d1tf0b_: