Lineage for d1tf0b_ (1tf0 B:)

  1. Root: SCOP 1.71
  2. 530466Class a: All alpha proteins [46456] (226 folds)
  3. 534682Fold a.8: immunoglobulin/albumin-binding domain-like [46996] (8 superfamilies)
    3 helices; bundle, closed, left-handed twist; up-and-down; mirror topology to the spectrin-like fold
  4. 534683Superfamily a.8.1: Bacterial immunoglobulin/albumin-binding domains [46997] (2 families) (S)
  5. 534703Family a.8.1.2: GA module, an albumin-binding domain [47001] (3 proteins)
    Pfam 01468; also includes FIVAR module, Pfam 07554
  6. 534714Protein PAB [47002] (1 species)
  7. 534715Species Peptostreptococcus magnus [TaxId:1260] [47003] (3 PDB entries)
  8. 534716Domain d1tf0b_: 1tf0 B: [106825]
    Other proteins in same PDB: d1tf0a1, d1tf0a2, d1tf0a3
    complexed with cit, dka

Details for d1tf0b_

PDB Entry: 1tf0 (more details), 2.7 Å

PDB Description: crystal structure of the ga module complexed with human serum albumin

SCOP Domain Sequences for d1tf0b_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1tf0b_ a.8.1.2 (B:) PAB {Peptostreptococcus magnus}
tidqwllknakedaiaelkkagitsdfyfnainkaktveevnalkneilkaha

SCOP Domain Coordinates for d1tf0b_:

Click to download the PDB-style file with coordinates for d1tf0b_.
(The format of our PDB-style files is described here.)

Timeline for d1tf0b_: