Lineage for d1tf0b_ (1tf0 B:)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 1985633Fold a.8: immunoglobulin/albumin-binding domain-like [46996] (11 superfamilies)
    3 helices; bundle, closed, left-handed twist; up-and-down; mirror topology to the spectrin-like fold
  4. 1985634Superfamily a.8.1: Bacterial immunoglobulin/albumin-binding domains [46997] (3 families) (S)
  5. 1985690Family a.8.1.2: GA module, an albumin-binding domain [47001] (4 protein domains)
    Pfam PF01468; also includes FIVAR module, Pfam PF07554
  6. 1985705Protein PAB [47002] (1 species)
  7. 1985706Species Peptostreptococcus magnus [TaxId:1260] [47003] (3 PDB entries)
    Uniprot Q51911 213-265
  8. 1985707Domain d1tf0b_: 1tf0 B: [106825]
    Other proteins in same PDB: d1tf0a1, d1tf0a2, d1tf0a3
    complexed with cit, dka

Details for d1tf0b_

PDB Entry: 1tf0 (more details), 2.7 Å

PDB Description: Crystal structure of the GA module complexed with human serum albumin
PDB Compounds: (B:) peptostreptococcal albumin-binding protein

SCOPe Domain Sequences for d1tf0b_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1tf0b_ a.8.1.2 (B:) PAB {Peptostreptococcus magnus [TaxId: 1260]}
tidqwllknakedaiaelkkagitsdfyfnainkaktveevnalkneilkaha

SCOPe Domain Coordinates for d1tf0b_:

Click to download the PDB-style file with coordinates for d1tf0b_.
(The format of our PDB-style files is described here.)

Timeline for d1tf0b_: