Lineage for d1tf0a3 (1tf0 A:389-572)

  1. Root: SCOP 1.69
  2. 436025Class a: All alpha proteins [46456] (218 folds)
  3. 448398Fold a.126: Serum albumin-like [48551] (1 superfamily)
    multihelical; one domain consists of two similar disulfide-linked subdomains
  4. 448399Superfamily a.126.1: Serum albumin-like [48552] (1 family) (S)
  5. 448400Family a.126.1.1: Serum albumin-like [48553] (2 proteins)
  6. 448401Protein Serum albumin [48554] (1 species)
    duplication: consists of three domains of this fold
  7. 448402Species Human (Homo sapiens) [TaxId:9606] [48555] (26 PDB entries)
  8. 448489Domain d1tf0a3: 1tf0 A:389-572 [106824]
    Other proteins in same PDB: d1tf0b_

Details for d1tf0a3

PDB Entry: 1tf0 (more details), 2.7 Å

PDB Description: crystal structure of the ga module complexed with human serum albumin

SCOP Domain Sequences for d1tf0a3:

Sequence; same for both SEQRES and ATOM records: (download)

>d1tf0a3 a.126.1.1 (A:389-572) Serum albumin {Human (Homo sapiens)}
kqncelfeqlgeykfqnallvrytkkvpqvstptlvevsrnlgkvgskcckhpeakrmpc
aedylsvvlnqlcvlhektpvsdrvtkccteslvnrrpcfsalevdetyvpkefnaetft
fhadictlsekerqikkqtalvelvkhkpkatkeqlkavmddfaafvekcckaddketcf
aeeg

SCOP Domain Coordinates for d1tf0a3:

Click to download the PDB-style file with coordinates for d1tf0a3.
(The format of our PDB-style files is described here.)

Timeline for d1tf0a3:

Domains from other chains:
(mouse over for more information)
d1tf0b_