![]() | Class a: All alpha proteins [46456] (218 folds) |
![]() | Fold a.126: Serum albumin-like [48551] (1 superfamily) multihelical; one domain consists of two similar disulfide-linked subdomains |
![]() | Superfamily a.126.1: Serum albumin-like [48552] (1 family) ![]() |
![]() | Family a.126.1.1: Serum albumin-like [48553] (2 proteins) |
![]() | Protein Serum albumin [48554] (1 species) duplication: consists of three domains of this fold |
![]() | Species Human (Homo sapiens) [TaxId:9606] [48555] (26 PDB entries) |
![]() | Domain d1tf0a3: 1tf0 A:389-572 [106824] Other proteins in same PDB: d1tf0b_ |
PDB Entry: 1tf0 (more details), 2.7 Å
SCOP Domain Sequences for d1tf0a3:
Sequence; same for both SEQRES and ATOM records: (download)
>d1tf0a3 a.126.1.1 (A:389-572) Serum albumin {Human (Homo sapiens)} kqncelfeqlgeykfqnallvrytkkvpqvstptlvevsrnlgkvgskcckhpeakrmpc aedylsvvlnqlcvlhektpvsdrvtkccteslvnrrpcfsalevdetyvpkefnaetft fhadictlsekerqikkqtalvelvkhkpkatkeqlkavmddfaafvekcckaddketcf aeeg
Timeline for d1tf0a3: