Lineage for d1tf0a2 (1tf0 A:197-388)

  1. Root: SCOP 1.75
  2. 758332Class a: All alpha proteins [46456] (284 folds)
  3. 777088Fold a.126: Serum albumin-like [48551] (1 superfamily)
    multihelical; one domain consists of two similar disulfide-linked subdomains
  4. 777089Superfamily a.126.1: Serum albumin-like [48552] (1 family) (S)
  5. 777090Family a.126.1.1: Serum albumin-like [48553] (2 proteins)
  6. 777091Protein Serum albumin [48554] (1 species)
    duplication: consists of three domains of this fold
  7. 777092Species Human (Homo sapiens) [TaxId:9606] [48555] (50 PDB entries)
    Uniprot P02768 29-596
  8. 777196Domain d1tf0a2: 1tf0 A:197-388 [106823]
    Other proteins in same PDB: d1tf0b_

Details for d1tf0a2

PDB Entry: 1tf0 (more details), 2.7 Å

PDB Description: crystal structure of the ga module complexed with human serum albumin
PDB Compounds: (A:) serum albumin

SCOP Domain Sequences for d1tf0a2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1tf0a2 a.126.1.1 (A:197-388) Serum albumin {Human (Homo sapiens) [TaxId: 9606]}
rlkcaslqkfgerafkawavarlsqrfpkaefaevsklvtdltkvhtecchgdllecadd
radlakyicenqdsissklkeccekpllekshciaevendempadlpslaadfveskdvc
knyaeakdvflgmflyeyarrhpdysvvlllrlaktyettlekccaaadphecyakvfde
fkplveepqnli

SCOP Domain Coordinates for d1tf0a2:

Click to download the PDB-style file with coordinates for d1tf0a2.
(The format of our PDB-style files is described here.)

Timeline for d1tf0a2:

View in 3D
Domains from other chains:
(mouse over for more information)
d1tf0b_