SCOPe 2.05: Domain d1tf0a1: 1tf0 A:5-196

Lineage for d1tf0a1 (1tf0 A:5-196)

1. Root: SCOPe 2.05

2. Class a: All alpha proteins [46456] (286 folds)

3. Fold a.126: Serum albumin-like [48551] (1 superfamily)
   multihelical; one domain consists of two similar disulfide-linked subdomains

4. Superfamily a.126.1: Serum albumin-like [48552] (2 families)

5. Family a.126.1.1: Serum albumin-like [48553] (2 proteins)

6. Protein Serum albumin [48554] (1 species)
   duplication: consists of three domains of this fold

7. Species Human (Homo sapiens) [TaxId:9606] [48555] (70 PDB entries)
   Uniprot P02768 29-596

8. Domain d1tf0a1: 1tf0 A:5-196 [106822]
   Other proteins in same PDB: d1tf0b_
   complexed with cit, dka

Details for d1tf0a1

PDB Entry: 1tf0, 2.7 Å

PDB Description: crystal structure of the ga module complexed with human serum albumin

PDB Compounds: (A:) serum albumin

SCOPe Domain Sequences for d1tf0a1:

Sequence, based on SEQRES records:

>d1tf0a1 a.126.1.1 (A:5-196) Serum albumin {Human (Homo sapiens) [TaxId: 9606]}
sevahrfkdlgeenfkalvliafaqylqqcpfedhvklvnevtefaktcvadesaencdk
slhtlfgdklctvatlretygemadccakqepernecflqhkddnpnlprlvrpevdvmc
tafhdneetflkkylyeiarrhpyfyapellffakrykaafteccqaadkaacllpklde
lrdegkassakq

Sequence, based on observed residues (ATOM records):

>d1tf0a1 a.126.1.1 (A:5-196) Serum albumin {Human (Homo sapiens) [TaxId: 9606]}
sevahrfkdlgeenfkalvliafaqylqqcpfedhvklvnevtefaktcvadesaencdk
slhtlfgdklctdccakqepernecflqhkddnpnlprlvrpevdvmctafhdneetflk
kylyeiarrhpyfyapellffakrykaafteccqaadkaacllpkldelrdegkassakq

Timeline for d1tf0a1:

• d1tf0a1 first appeared in SCOP 1.69
  
• d1tf0a1 appears in SCOPe 2.04
  
• d1tf0a1 appears in SCOPe 2.06
  
• d1tf0a1 appears in the current release, SCOPe 2.08