Lineage for d1tf0a1 (1tf0 A:5-196)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 2009789Fold a.126: Serum albumin-like [48551] (1 superfamily)
    multihelical; one domain consists of two similar disulfide-linked subdomains
  4. 2009790Superfamily a.126.1: Serum albumin-like [48552] (2 families) (S)
  5. 2009791Family a.126.1.1: Serum albumin-like [48553] (2 protein domains)
  6. 2009792Protein Serum albumin [48554] (1 species)
    duplication: consists of three domains of this fold
  7. 2009793Species Human (Homo sapiens) [TaxId:9606] [48555] (73 PDB entries)
    Uniprot P02768 29-596
  8. 2010025Domain d1tf0a1: 1tf0 A:5-196 [106822]
    Other proteins in same PDB: d1tf0b_
    complexed with cit, dka

Details for d1tf0a1

PDB Entry: 1tf0 (more details), 2.7 Å

PDB Description: Crystal structure of the GA module complexed with human serum albumin
PDB Compounds: (A:) serum albumin

SCOPe Domain Sequences for d1tf0a1:

Sequence, based on SEQRES records: (download)

>d1tf0a1 a.126.1.1 (A:5-196) Serum albumin {Human (Homo sapiens) [TaxId: 9606]}
sevahrfkdlgeenfkalvliafaqylqqcpfedhvklvnevtefaktcvadesaencdk
slhtlfgdklctvatlretygemadccakqepernecflqhkddnpnlprlvrpevdvmc
tafhdneetflkkylyeiarrhpyfyapellffakrykaafteccqaadkaacllpklde
lrdegkassakq

Sequence, based on observed residues (ATOM records): (download)

>d1tf0a1 a.126.1.1 (A:5-196) Serum albumin {Human (Homo sapiens) [TaxId: 9606]}
sevahrfkdlgeenfkalvliafaqylqqcpfedhvklvnevtefaktcvadesaencdk
slhtlfgdklctdccakqepernecflqhkddnpnlprlvrpevdvmctafhdneetflk
kylyeiarrhpyfyapellffakrykaafteccqaadkaacllpkldelrdegkassakq

SCOPe Domain Coordinates for d1tf0a1:

Click to download the PDB-style file with coordinates for d1tf0a1.
(The format of our PDB-style files is described here.)

Timeline for d1tf0a1:

View in 3D
Domains from other chains:
(mouse over for more information)
d1tf0b_