Lineage for d1texb_ (1tex B:)

  1. Root: SCOP 1.69
  2. 473232Class c: Alpha and beta proteins (a/b) [51349] (136 folds)
  3. 483669Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
    3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes
  4. 483670Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (22 families) (S)
    division into families based on beta-sheet topologies
  5. 484015Family c.37.1.5: PAPS sulfotransferase [52575] (12 proteins)
    Pfam 00685
    similar to the nucleotide/nucleoside kinases but transfer sulphate group
  6. 484072Protein Stf0 sulfotransferase [110530] (1 species)
  7. 484073Species Mycobacterium smegmatis [TaxId:1772] [110531] (1 PDB entry)
  8. 484075Domain d1texb_: 1tex B: [106819]

Details for d1texb_

PDB Entry: 1tex (more details), 2.6 Å

PDB Description: Mycobacterium smegmatis Stf0 Sulfotransferase with Trehalose

SCOP Domain Sequences for d1texb_:

Sequence, based on SEQRES records: (download)

>d1texb_ c.37.1.5 (B:) Stf0 sulfotransferase {Mycobacterium smegmatis}
hptaylvlasqrsgstllveslratgvagepqeffqylpntsmspqprewfadvedqsil
rlldpliegkpdlapatiwrdyiqtvgrtpngvwggklmwnqtpllvqrakdlpdrsgsg
llsairdvvgsdpvlihihrpdvvsqavsfwravqtrvwrgrpdpvrdaraeyhagaiah
vitmlraqeegwrawfteenvepidvdypylwrnltevvgtvlealgqdprlapkpvler
qadqrsdewveryrrdaqrdglpl

Sequence, based on observed residues (ATOM records): (download)

>d1texb_ c.37.1.5 (B:) Stf0 sulfotransferase {Mycobacterium smegmatis}
hptaylvlasqrsgstllveslratgvagepqeffqylpntsmspqprewfadvedqsil
rlldpliegkpdlapatiwrdyiqtvgrtpngvwggklmwnqtpllvqrakdlpdrsgsg
llsairdvvgsdpvlihihrpdvvsqavsfwravqtrvwrdaraeyhagaiahvitmlra
qeegwrawfteenvepidvdypylwrnltevvgtvlealgqdprlapkrsdewveryrrd
lpl

SCOP Domain Coordinates for d1texb_:

Click to download the PDB-style file with coordinates for d1texb_.
(The format of our PDB-style files is described here.)

Timeline for d1texb_: