![]() | Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
![]() | Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily) 3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes |
![]() | Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (27 families) ![]() division into families based on beta-sheet topologies |
![]() | Family c.37.1.1: Nucleotide and nucleoside kinases [52541] (21 proteins) parallel beta-sheet of 5 strands, order 23145 |
![]() | Protein UMP/CMP kinase [52550] (2 species) |
![]() | Species Human (Homo sapiens) [TaxId:9606] [110526] (1 PDB entry) Uniprot P30085 |
![]() | Domain d1teva_: 1tev A: [106817] complexed with so4 |
PDB Entry: 1tev (more details), 2.1 Å
SCOPe Domain Sequences for d1teva_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1teva_ c.37.1.1 (A:) UMP/CMP kinase {Human (Homo sapiens) [TaxId: 9606]} plvvfvlggpgagkgtqcarivekygythlsagellrderknpdsqygeliekyikegki vpveitisllkremdqtmaanaqknkflidgfprnqdnlqgwnktmdgkadvsfvlffdc nneicierclergkssgrsddnreslekriqtylqstkpiidlyeemgkvkkidasksvd evfdevvqifdkeg
Timeline for d1teva_: