Lineage for d1teva_ (1tev A:)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2865683Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
    3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes
  4. 2865684Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (27 families) (S)
    division into families based on beta-sheet topologies
  5. 2865685Family c.37.1.1: Nucleotide and nucleoside kinases [52541] (21 proteins)
    parallel beta-sheet of 5 strands, order 23145
  6. 2866219Protein UMP/CMP kinase [52550] (2 species)
  7. 2866220Species Human (Homo sapiens) [TaxId:9606] [110526] (1 PDB entry)
    Uniprot P30085
  8. 2866221Domain d1teva_: 1tev A: [106817]
    complexed with so4

Details for d1teva_

PDB Entry: 1tev (more details), 2.1 Å

PDB Description: crystal structure of the human ump/cmp kinase in open conformation
PDB Compounds: (A:) UMP-CMP kinase

SCOPe Domain Sequences for d1teva_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1teva_ c.37.1.1 (A:) UMP/CMP kinase {Human (Homo sapiens) [TaxId: 9606]}
plvvfvlggpgagkgtqcarivekygythlsagellrderknpdsqygeliekyikegki
vpveitisllkremdqtmaanaqknkflidgfprnqdnlqgwnktmdgkadvsfvlffdc
nneicierclergkssgrsddnreslekriqtylqstkpiidlyeemgkvkkidasksvd
evfdevvqifdkeg

SCOPe Domain Coordinates for d1teva_:

Click to download the PDB-style file with coordinates for d1teva_.
(The format of our PDB-style files is described here.)

Timeline for d1teva_: