SCOPe 2.08: Domain d1te6b1: 1te6 B:140-433

Lineage for d1te6b1 (1te6 B:140-433)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.1: TIM beta/alpha-barrel [51350] (34 superfamilies)
   contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
   the first seven superfamilies have similar phosphate-binding sites

4. Superfamily c.1.11: Enolase C-terminal domain-like [51604] (3 families)
   binds metal ion (magnesium or manganese) in conserved site inside barrel
   N-terminal alpha+beta domain is common to this superfamily

5. Family c.1.11.1: Enolase [51605] (2 proteins)
   automatically mapped to Pfam PF00113

6. Protein Enolase [51606] (11 species)
   Fold of this protein slightly differs from common fold in topology

7. Species Human (Homo sapiens), gamma isoform [TaxId:9606] [110371] (15 PDB entries)
   Uniprot P09104

8. Domain d1te6b1: 1te6 B:140-433 [106799]
   Other proteins in same PDB: d1te6a2, d1te6a3, d1te6b2
   complexed with cl, mg, po4, trs

Details for d1te6b1

PDB Entry: 1te6, 1.8 Å

PDB Description: crystal structure of human neuron specific enolase at 1.8 angstrom

PDB Compounds: (B:) Gamma enolase

SCOPe Domain Sequences for d1te6b1:

Sequence; same for both SEQRES and ATOM records:

>d1te6b1 c.1.11.1 (B:140-433) Enolase {Human (Homo sapiens), gamma isoform [TaxId: 9606]}
sdlilpvpafnvinggshagnklamqefmilpvgaesfrdamrlgaevyhtlkgvikdky
gkdatnvgdeggfapnilensealelvkeaidkagytekivigmdvaasefyrdgkydld
fksptdpsryitgdqlgalyqdfvrdypvvsiedpfdqddwaawskftanvgiqivgddl
tvtnpkrieraveekacnclllkvnqigsvteaiqacklaqengwgvmvshrsgetedtf
iadlvvglctgqiktgapcrserlakynqlmrieeelgdearfaghnfrnpsvl

Timeline for d1te6b1:

• d1te6b1 first appeared in SCOP 1.69
  
• d1te6b1 appears in SCOPe 2.07