Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies) contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678 the first seven superfamilies have similar phosphate-binding sites |
Superfamily c.1.11: Enolase C-terminal domain-like [51604] (3 families) binds metal ion (magnesium or manganese) in conserved site inside barrel N-terminal alpha+beta domain is common to this superfamily |
Family c.1.11.1: Enolase [51605] (2 proteins) automatically mapped to Pfam PF00113 |
Protein Enolase [51606] (10 species) Fold of this protein slightly differs from common fold in topology |
Species Human (Homo sapiens), gamma isoform [TaxId:9606] [110371] (15 PDB entries) Uniprot P09104 |
Domain d1te6a1: 1te6 A:140-433 [106797] Other proteins in same PDB: d1te6a2, d1te6a3, d1te6b2 complexed with cl, mg, po4, trs |
PDB Entry: 1te6 (more details), 1.8 Å
SCOPe Domain Sequences for d1te6a1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1te6a1 c.1.11.1 (A:140-433) Enolase {Human (Homo sapiens), gamma isoform [TaxId: 9606]} sdlilpvpafnvinggshagnklamqefmilpvgaesfrdamrlgaevyhtlkgvikdky gkdatnvgdeggfapnilensealelvkeaidkagytekivigmdvaasefyrdgkydld fksptdpsryitgdqlgalyqdfvrdypvvsiedpfdqddwaawskftanvgiqivgddl tvtnpkrieraveekacnclllkvnqigsvteaiqacklaqengwgvmvshrsgetedtf iadlvvglctgqiktgapcrserlakynqlmrieeelgdearfaghnfrnpsvl
Timeline for d1te6a1: