SCOPe 2.08: Domain d1te5b_: 1te5 B:

Lineage for d1te5b_ (1te5 B:)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.153: Ntn hydrolase-like [56234] (2 superfamilies)
   4 layers: alpha/beta/beta/alpha; has an unusual sheet-to-sheet packing

4. Superfamily d.153.1: N-terminal nucleophile aminohydrolases (Ntn hydrolases) [56235] (8 families)
   N-terminal residue provides two catalytic groups, nucleophile and proton donor

5. Family d.153.1.1: Class II glutamine amidotransferases [56236] (6 proteins)
   has slightly different topology than other families do

6. Protein Hypothetical protein YafJ (PA1307) [111217] (1 species)

7. Species Pseudomonas aeruginosa [TaxId:287] [111218] (1 PDB entry)
   Uniprot Q9I437

8. Domain d1te5b_: 1te5 B: [106796]

Details for d1te5b_

PDB Entry: 1te5, 2 Å

PDB Description: the 2.0 angstrom crystal structure of predicted glutamine amidotransferase from pseudomonas aeruginosa pa01

PDB Compounds: (B:) conserved hypothetical protein

SCOPe Domain Sequences for d1te5b_:

Sequence; same for both SEQRES and ATOM records:

>d1te5b_ d.153.1.1 (B:) Hypothetical protein YafJ (PA1307) {Pseudomonas aeruginosa [TaxId: 287]}
cellgmsanvptdivfsftglmqrgggtgphrdgwgiafyegrgvrlfqdplasvdseva
rlvqrfpiksetvighirqanvgkvglsnthpfirelggrywtfahngqladfqpkpgfy
rpvgetdseaafcdllnrvrrafpepvpvevllpvlisacdeyrkkgvfnalisdgdwlf
tfcssklayitrrapfgparlkdadltvdfhaettpddvvtviatepltdnenwtlqqsg
ewvlwwggevlak

Timeline for d1te5b_:

• d1te5b_ first appeared in SCOP 1.69
  
• d1te5b_ appears in SCOPe 2.07