Lineage for d1te5a_ (1te5 A:)

  1. Root: SCOPe 2.07
  2. 2530962Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2594580Fold d.153: Ntn hydrolase-like [56234] (2 superfamilies)
    4 layers: alpha/beta/beta/alpha; has an unusual sheet-to-sheet packing
  4. 2594581Superfamily d.153.1: N-terminal nucleophile aminohydrolases (Ntn hydrolases) [56235] (8 families) (S)
    N-terminal residue provides two catalytic groups, nucleophile and proton donor
  5. 2594582Family d.153.1.1: Class II glutamine amidotransferases [56236] (7 proteins)
    has slightly different topology than other families do
  6. 2594678Protein Hypothetical protein YafJ (PA1307) [111217] (1 species)
  7. 2594679Species Pseudomonas aeruginosa [TaxId:287] [111218] (1 PDB entry)
    Uniprot Q9I437
  8. 2594680Domain d1te5a_: 1te5 A: [106795]

Details for d1te5a_

PDB Entry: 1te5 (more details), 2 Å

PDB Description: the 2.0 angstrom crystal structure of predicted glutamine amidotransferase from pseudomonas aeruginosa pa01
PDB Compounds: (A:) conserved hypothetical protein

SCOPe Domain Sequences for d1te5a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1te5a_ d.153.1.1 (A:) Hypothetical protein YafJ (PA1307) {Pseudomonas aeruginosa [TaxId: 287]}
cellgmsanvptdivfsftglmqrgggtgphrdgwgiafyegrgvrlfqdplasvdseva
rlvqrfpiksetvighirqanvgkvglsnthpfirelggrywtfahngqladfqpkpgfy
rpvgetdseaafcdllnrvrrafpepvpvevllpvlisacdeyrkkgvfnalisdgdwlf
tfcssklayitrrapfgparlkdadltvdfhaettpddvvtviatepltdnenwtlqqsg
ewvlwwggevlak

SCOPe Domain Coordinates for d1te5a_:

Click to download the PDB-style file with coordinates for d1te5a_.
(The format of our PDB-style files is described here.)

Timeline for d1te5a_:

View in 3D
Domains from other chains:
(mouse over for more information)
d1te5b_