Lineage for d1te5a_ (1te5 A:)

  1. Root: SCOP 1.69
  2. 496776Class d: Alpha and beta proteins (a+b) [53931] (279 folds)
  3. 512789Fold d.153: Ntn hydrolase-like [56234] (2 superfamilies)
    4 layers: alpha/beta/beta/alpha; has an unusual sheet-to-sheet packing
  4. 512790Superfamily d.153.1: N-terminal nucleophile aminohydrolases (Ntn hydrolases) [56235] (5 families) (S)
    N-terminal residue provides two catalytic groups, nucleophile and proton donor
  5. 512791Family d.153.1.1: Class II glutamine amidotransferases [56236] (6 proteins)
    has slightly different topology than other families do
  6. 512865Protein Hypothetical protein YafJ (PA1307) [111217] (1 species)
  7. 512866Species Pseudomonas aeruginosa [TaxId:287] [111218] (1 PDB entry)
  8. 512867Domain d1te5a_: 1te5 A: [106795]

Details for d1te5a_

PDB Entry: 1te5 (more details), 2 Å

PDB Description: the 2.0 angstrom crystal structure of predicted glutamine amidotransferase from pseudomonas aeruginosa pa01

SCOP Domain Sequences for d1te5a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1te5a_ d.153.1.1 (A:) Hypothetical protein YafJ (PA1307) {Pseudomonas aeruginosa}
cellgmsanvptdivfsftglmqrgggtgphrdgwgiafyegrgvrlfqdplasvdseva
rlvqrfpiksetvighirqanvgkvglsnthpfirelggrywtfahngqladfqpkpgfy
rpvgetdseaafcdllnrvrrafpepvpvevllpvlisacdeyrkkgvfnalisdgdwlf
tfcssklayitrrapfgparlkdadltvdfhaettpddvvtviatepltdnenwtlqqsg
ewvlwwggevlak

SCOP Domain Coordinates for d1te5a_:

Click to download the PDB-style file with coordinates for d1te5a_.
(The format of our PDB-style files is described here.)

Timeline for d1te5a_:

View in 3D
Domains from other chains:
(mouse over for more information)
d1te5b_