![]() | Class c: Alpha and beta proteins (a/b) [51349] (136 folds) |
![]() | Fold c.108: HAD-like [56783] (1 superfamily) 3 layers: a/b/a; parallel beta-sheet of 6 strands, order 321456 |
![]() | Superfamily c.108.1: HAD-like [56784] (16 families) ![]() contains an insert alpha+beta subdomain; similar overall fold to the Cof family usually contains an insertion (sub)domain after strand 1 |
![]() | Family c.108.1.6: beta-Phosphoglucomutase-like [75173] (2 proteins) the insertion subdomain is a 4-helical bundle |
![]() | Protein Phosphatase YniC [110504] (1 species) |
![]() | Species Escherichia coli [TaxId:562] [110505] (1 PDB entry) |
![]() | Domain d1te2b_: 1te2 B: [106793] Structural genomics target |
PDB Entry: 1te2 (more details), 1.76 Å
SCOP Domain Sequences for d1te2b_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1te2b_ c.108.1.6 (B:) Phosphatase YniC {Escherichia coli} rqilaaifdmdgllidseplwdraeldvmaslgvdisrrnelpdtlglridmvvdlwyar qpwngpsrqevverviaraislveetrpllpgvreavalckeqgllvglasasplhmlek vltmfdlrdsfdalasaeklpyskphpqvyldcaaklgvdpltcvaledsvngmiaskaa rmrsivvpapeaqndprfvlanvklsslteltakdllg
Timeline for d1te2b_: