Lineage for d1te2a_ (1te2 A:)

  1. Root: SCOP 1.69
  2. 473232Class c: Alpha and beta proteins (a/b) [51349] (136 folds)
  3. 495850Fold c.108: HAD-like [56783] (1 superfamily)
    3 layers: a/b/a; parallel beta-sheet of 6 strands, order 321456
  4. 495851Superfamily c.108.1: HAD-like [56784] (16 families) (S)
    contains an insert alpha+beta subdomain; similar overall fold to the Cof family
    usually contains an insertion (sub)domain after strand 1
  5. 495940Family c.108.1.6: beta-Phosphoglucomutase-like [75173] (2 proteins)
    the insertion subdomain is a 4-helical bundle
  6. 495947Protein Phosphatase YniC [110504] (1 species)
  7. 495948Species Escherichia coli [TaxId:562] [110505] (1 PDB entry)
  8. 495949Domain d1te2a_: 1te2 A: [106792]

Details for d1te2a_

PDB Entry: 1te2 (more details), 1.76 Å

PDB Description: putative phosphatase ynic from escherichia coli k12

SCOP Domain Sequences for d1te2a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1te2a_ c.108.1.6 (A:) Phosphatase YniC {Escherichia coli}
rqilaaifdmdgllidseplwdraeldvmaslgvdisrrnelpdtlglridmvvdlwyar
qpwngpsrqevverviaraislveetrpllpgvreavalckeqgllvglasasplhmlek
vltmfdlrdsfdalasaeklpyskphpqvyldcaaklgvdpltcvaledsvngmiaskaa
rmrsivvpapeaqndprfvlanvklsslteltakdllg

SCOP Domain Coordinates for d1te2a_:

Click to download the PDB-style file with coordinates for d1te2a_.
(The format of our PDB-style files is described here.)

Timeline for d1te2a_: