Lineage for d1te1b_ (1te1 B:)

  1. Root: SCOP 1.69
  2. 450777Class b: All beta proteins [48724] (144 folds)
  3. 459805Fold b.29: Concanavalin A-like lectins/glucanases [49898] (1 superfamily)
    sandwich; 12-14 strands in 2 sheets; complex topology
  4. 459806Superfamily b.29.1: Concanavalin A-like lectins/glucanases [49899] (21 families) (S)
  5. 460534Family b.29.1.11: Xylanase/endoglucanase 11/12 [49978] (2 proteins)
  6. 460573Protein Xylanase II [49979] (16 species)
    Partial overlap with common fold and the active sites of the other endoglucanases
  7. 460620Species Penicillium funiculosum [TaxId:28572] [110142] (1 PDB entry)
  8. 460621Domain d1te1b_: 1te1 B: [106791]
    Other proteins in same PDB: d1te1a_

Details for d1te1b_

PDB Entry: 1te1 (more details), 2.5 Å

PDB Description: crystal structure of family 11 xylanase in complex with inhibitor (xip-i)

SCOP Domain Sequences for d1te1b_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1te1b_ b.29.1.11 (B:) Xylanase II {Penicillium funiculosum}
qsittsqtgtnngyyysfwtngggevtytngdngeysvtwvdcgdftsgkgwnpanaqtv
tysgefnpsgnaylavygwttdplveyyilesygtynpssgltslgqvtsdggtydiyst
qrvnqpsiegtstfnqywsvrtekrvggtvttanhfaawkalglemgtynymivstegye
ssgsstitvs

SCOP Domain Coordinates for d1te1b_:

Click to download the PDB-style file with coordinates for d1te1b_.
(The format of our PDB-style files is described here.)

Timeline for d1te1b_: