SCOPe 2.08: Domain d1te1b_: 1te1 B:

Lineage for d1te1b_ (1te1 B:)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.29: Concanavalin A-like lectins/glucanases [49898] (1 superfamily)
   sandwich; 12-14 strands in 2 sheets; complex topology

4. Superfamily b.29.1: Concanavalin A-like lectins/glucanases [49899] (27 families)

5. Family b.29.1.11: Xylanase/endoglucanase 11/12 [49978] (3 proteins)

6. Protein Xylanase II [49979] (21 species)
   Partial overlap with common fold and the active sites of the other endoglucanases

7. Species Penicillium funiculosum [TaxId:28572] [110142] (2 PDB entries)
   Uniprot Q9HFH0

8. Domain d1te1b_: 1te1 B: [106791]
   Other proteins in same PDB: d1te1a_
   complexed with edo, nag

Details for d1te1b_

PDB Entry: 1te1, 2.5 Å

PDB Description: crystal structure of family 11 xylanase in complex with inhibitor (xip-i)

PDB Compounds: (B:) endo-1,4-xylanase

SCOPe Domain Sequences for d1te1b_:

Sequence; same for both SEQRES and ATOM records:

>d1te1b_ b.29.1.11 (B:) Xylanase II {Penicillium funiculosum [TaxId: 28572]}
qsittsqtgtnngyyysfwtngggevtytngdngeysvtwvdcgdftsgkgwnpanaqtv
tysgefnpsgnaylavygwttdplveyyilesygtynpssgltslgqvtsdggtydiyst
qrvnqpsiegtstfnqywsvrtekrvggtvttanhfaawkalglemgtynymivstegye
ssgsstitvs

Timeline for d1te1b_:

• d1te1b_ first appeared in SCOP 1.69
  
• d1te1b_ appears in SCOPe 2.07