SCOPe 2.08: Domain d1te1a_: 1te1 A:

Lineage for d1te1a_ (1te1 A:)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.1: TIM beta/alpha-barrel [51350] (34 superfamilies)
   contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
   the first seven superfamilies have similar phosphate-binding sites

4. Superfamily c.1.8: (Trans)glycosidases [51445] (15 families)

5. Family c.1.8.5: Type II chitinase [51534] (15 proteins)
   glycosylase family 18

6. Protein Xylanase inhibitor protein I, XIP-I [89478] (1 species)

7. Species Wheat (Triticum aestivum) [TaxId:4565] [89479] (3 PDB entries)
   Uniprot Q8L5C6

8. Domain d1te1a_: 1te1 A: [106790]
   Other proteins in same PDB: d1te1b_
   complexed with edo, nag

Details for d1te1a_

PDB Entry: 1te1, 2.5 Å

PDB Description: crystal structure of family 11 xylanase in complex with inhibitor (xip-i)

PDB Compounds: (A:) Xylanase Inhibitor Protein I

SCOPe Domain Sequences for d1te1a_:

Sequence; same for both SEQRES and ATOM records:

>d1te1a_ c.1.8.5 (A:) Xylanase inhibitor protein I, XIP-I {Wheat (Triticum aestivum) [TaxId: 4565]}
aggktgqvtvfwgrnkaegslreacdsgmytmvtmsfldvfgangkyhldlsghdlssvg
adikhcqskgvpvslsiggygtgyslpsnrsaldlfdhlwnsyfggskpsvprpfgdawl
dgvdlflehgtpadrydvlalelakhnirggpgkplhltatvrcgyppaahvgralatgi
fervhvrtyesdkwcnqnlgwegswdkwtaaypatrfyvgltaddkshqwvhpknvyygv
apvaqkkdnyggimlwdryfdkqtnysslikyya

Timeline for d1te1a_:

• d1te1a_ first appeared in SCOP 1.69
  
• d1te1a_ appears in SCOPe 2.07