Lineage for d1tdza3 (1tdz A:225-271)

  1. Root: SCOPe 2.08
  2. 3029608Class g: Small proteins [56992] (100 folds)
  3. 3035586Fold g.39: Glucocorticoid receptor-like (DNA-binding domain) [57715] (1 superfamily)
    alpha+beta metal(zinc)-bound fold
  4. 3035587Superfamily g.39.1: Glucocorticoid receptor-like (DNA-binding domain) [57716] (19 families) (S)
  5. 3035992Family g.39.1.8: C-terminal, Zn-finger domain of MutM-like DNA repair proteins [81627] (3 proteins)
  6. 3035993Protein DNA repair protein MutM (Fpg) [81622] (4 species)
  7. 3036023Species Lactococcus lactis [TaxId:1358] [81619] (7 PDB entries)
    Uniprot P42371
  8. 3036024Domain d1tdza3: 1tdz A:225-271 [106789]
    Other proteins in same PDB: d1tdza1, d1tdza2
    protein/DNA complex; complexed with gol, zn

Details for d1tdza3

PDB Entry: 1tdz (more details), 1.8 Å

PDB Description: Crystal Structure Complex Between the Lactococcus Lactis FPG (Mutm) and a FAPY-dG Containing DNA
PDB Compounds: (A:) formamidopyrimidine-DNA glycosylase

SCOPe Domain Sequences for d1tdza3:

Sequence; same for both SEQRES and ATOM records: (download)

>d1tdza3 g.39.1.8 (A:225-271) DNA repair protein MutM (Fpg) {Lactococcus lactis [TaxId: 1358]}
lgstgkmqnelqvygktgekcsrcgaeiqkikvagrgthfcpvcqqk

SCOPe Domain Coordinates for d1tdza3:

Click to download the PDB-style file with coordinates for d1tdza3.
(The format of our PDB-style files is described here.)

Timeline for d1tdza3: