Lineage for d1tdza2 (1tdz A:2-131)

  1. Root: SCOP 1.75
  2. 781541Class b: All beta proteins [48724] (174 folds)
  3. 812259Fold b.113: N-terminal domain of MutM-like DNA repair proteins [81625] (1 superfamily)
    pseudobarrel; capped on both ends by alpha-helices
  4. 812260Superfamily b.113.1: N-terminal domain of MutM-like DNA repair proteins [81624] (1 family) (S)
  5. 812261Family b.113.1.1: N-terminal domain of MutM-like DNA repair proteins [81623] (3 proteins)
  6. 812262Protein DNA repair protein MutM (Fpg) [81621] (4 species)
  7. 812278Species Lactococcus lactis [TaxId:1358] [81617] (7 PDB entries)
    Uniprot P42371
  8. 812279Domain d1tdza2: 1tdz A:2-131 [106788]
    Other proteins in same PDB: d1tdza1, d1tdza3
    complexed with fox, gol, zn

Details for d1tdza2

PDB Entry: 1tdz (more details), 1.8 Å

PDB Description: Crystal Structure Complex Between the Lactococcus Lactis FPG (Mutm) and a FAPY-dG Containing DNA
PDB Compounds: (A:) formamidopyrimidine-DNA glycosylase

SCOP Domain Sequences for d1tdza2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1tdza2 b.113.1.1 (A:2-131) DNA repair protein MutM (Fpg) {Lactococcus lactis [TaxId: 1358]}
elpevetvrrelekrivgqkiisieatyprmvltgfeqlkkeltgktiqgisrrgkylif
eigddfrlishlrmegkyrlatldaprekhdhltmkfadgqliyadvrkfgtwelistdq
vlpyflkkki

SCOP Domain Coordinates for d1tdza2:

Click to download the PDB-style file with coordinates for d1tdza2.
(The format of our PDB-style files is described here.)

Timeline for d1tdza2: