Lineage for d1tdza1 (1tdz A:132-219)

  1. Root: SCOP 1.73
  2. 631650Class a: All alpha proteins [46456] (258 folds)
  3. 650278Fold a.156: S13-like H2TH domain [81297] (1 superfamily)
    core: 3-4 helices
  4. 650279Superfamily a.156.1: S13-like H2TH domain [46946] (3 families) (S)
    contains a helix-two turns-helix (H2TH) motif
  5. 650319Family a.156.1.2: Middle domain of MutM-like DNA repair proteins [81626] (3 proteins)
    contains 4 helices in the core
  6. 650320Protein DNA repair protein MutM (Fpg) [81620] (4 species)
  7. 650336Species Lactococcus lactis [TaxId:1358] [81615] (7 PDB entries)
  8. 650337Domain d1tdza1: 1tdz A:132-219 [106787]
    Other proteins in same PDB: d1tdza2, d1tdza3
    complexed with fox, gol, zn

Details for d1tdza1

PDB Entry: 1tdz (more details), 1.8 Å

PDB Description: Crystal Structure Complex Between the Lactococcus Lactis FPG (Mutm) and a FAPY-dG Containing DNA
PDB Compounds: (A:) formamidopyrimidine-DNA glycosylase

SCOP Domain Sequences for d1tdza1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1tdza1 a.156.1.2 (A:132-219) DNA repair protein MutM (Fpg) {Lactococcus lactis [TaxId: 1358]}
gpeptyedfdeklfreklrkstkkikpylleqtlvaglgniyvdevlwlakihpeketnq
liessihllhdsiieilqkaiklggssi

SCOP Domain Coordinates for d1tdza1:

Click to download the PDB-style file with coordinates for d1tdza1.
(The format of our PDB-style files is described here.)

Timeline for d1tdza1: