SCOP 1.71: Domain d1tdqb_: 1tdq B:

Lineage for d1tdqb_ (1tdq B:)

1. Root: SCOP 1.71

2. Class d: Alpha and beta proteins (a+b) [53931] (286 folds)

3. Fold d.169: C-type lectin-like [56435] (1 superfamily)
   unusual fold

4. Superfamily d.169.1: C-type lectin-like [56436] (6 families)

5. Family d.169.1.1: C-type lectin domain [56437] (26 proteins)
   Pfam 00059

6. Protein Aggrecan core protein [111260] (1 species)

7. Species Rat (Rattus norvegicus) [TaxId:10116] [111261] (1 PDB entry)

8. Domain d1tdqb_: 1tdq B: [106785]
   Other proteins in same PDB: d1tdqa1, d1tdqa2, d1tdqa3
   complexed with ca

Details for d1tdqb_

PDB Entry: 1tdq, 2.6 Å

PDB Description: structural basis for the interactions between tenascins and the c-type lectin domains from lecticans: evidence for a cross-linking role for tenascins

SCOP Domain Sequences for d1tdqb_:

Sequence; same for both SEQRES and ATOM records:

>d1tdqb_ d.169.1.1 (B:) Aggrecan core protein {Rat (Rattus norvegicus)}
eqceegwtkfqghcyrhfpdretwvdaerrcreqqshlssivtpeeqefvnknaqdyqwi
glndrtiegdfrwsdghslqfekwrpnqpdnffatgedcvvmiwhergewndvpcnyqlp
ftckkg

Timeline for d1tdqb_:

• d1tdqb_ first appeared in SCOP 1.69
  
• d1tdqb_ appears in SCOP 1.73
  
• d1tdqb_ appears in the current release, SCOPe 2.08