SCOP 1.69: Domain d1tdqa3: 1tdq A:186-271

Lineage for d1tdqa3 (1tdq A:186-271)

1. Root: SCOP 1.69

2. Class b: All beta proteins [48724] (144 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (23 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.2: Fibronectin type III [49265] (1 family)

5. Family b.1.2.1: Fibronectin type III [49266] (24 proteins)

6. Protein Tenascin [49273] (3 species)

7. Species Rat (Rattus norvegicus) [TaxId:10116] [110057] (1 PDB entry)

8. Domain d1tdqa3: 1tdq A:186-271 [106784]
   Other proteins in same PDB: d1tdqb_

Details for d1tdqa3

PDB Entry: 1tdq, 2.6 Å

PDB Description: structural basis for the interactions between tenascins and the c-type lectin domains from lecticans: evidence for a cross-linking role for tenascins

SCOP Domain Sequences for d1tdqa3:

Sequence; same for both SEQRES and ATOM records:

>d1tdqa3 b.1.2.1 (A:186-271) Tenascin {Rat (Rattus norvegicus)}
ldsprdlmvtassetsisliwtkasgpidhyritftpssgissevtvprdrtsytltdle
pgaeyiisitaergrqqslestvdaf

Timeline for d1tdqa3:

• d1tdqa3 is new in SCOP 1.69
  
• d1tdqa3 appears in SCOP 1.71
  
• d1tdqa3 appears in the current release, SCOPe 2.08