Lineage for d1tdqa1 (1tdq A:1-93)

  1. Root: SCOPe 2.04
  2. 1510239Class b: All beta proteins [48724] (176 folds)
  3. 1510240Fold b.1: Immunoglobulin-like beta-sandwich [48725] (31 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 1521239Superfamily b.1.2: Fibronectin type III [49265] (2 families) (S)
  5. 1521240Family b.1.2.1: Fibronectin type III [49266] (45 proteins)
    Pfam PF00041
  6. 1521659Protein Tenascin [49273] (3 species)
  7. 1521667Species Norway rat (Rattus norvegicus) [TaxId:10116] [110057] (1 PDB entry)
    Uniprot Q05546 502-770
  8. 1521668Domain d1tdqa1: 1tdq A:1-93 [106782]
    Other proteins in same PDB: d1tdqb_
    complexed with ca

Details for d1tdqa1

PDB Entry: 1tdq (more details), 2.6 Å

PDB Description: structural basis for the interactions between tenascins and the c-type lectin domains from lecticans: evidence for a cross-linking role for tenascins
PDB Compounds: (A:) Tenascin-R

SCOPe Domain Sequences for d1tdqa1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1tdqa1 b.1.2.1 (A:1-93) Tenascin {Norway rat (Rattus norvegicus) [TaxId: 10116]}
ipvidgptqilvrdvsdtvafvewtpprakvdfillkyglvggeggkttfrlqpplsqys
vqalrpgsryevsisavrgtnesdasstqftte

SCOPe Domain Coordinates for d1tdqa1:

Click to download the PDB-style file with coordinates for d1tdqa1.
(The format of our PDB-style files is described here.)

Timeline for d1tdqa1:

View in 3D
Domains from other chains:
(mouse over for more information)
d1tdqb_