SCOPe 2.08: Domain d1tdqa1: 1tdq A:3-93

Lineage for d1tdqa1 (1tdq A:3-93)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.2: Fibronectin type III [49265] (2 families)

5. Family b.1.2.1: Fibronectin type III [49266] (45 proteins)
   Pfam PF00041

6. Protein Tenascin [49273] (3 species)

7. Species Norway rat (Rattus norvegicus) [TaxId:10116] [110057] (1 PDB entry)
   Uniprot Q05546 502-770

8. Domain d1tdqa1: 1tdq A:3-93 [106782]
   Other proteins in same PDB: d1tdqa4, d1tdqb_
   complexed with ca

Details for d1tdqa1

PDB Entry: 1tdq, 2.6 Å

PDB Description: structural basis for the interactions between tenascins and the c-type lectin domains from lecticans: evidence for a cross-linking role for tenascins

PDB Compounds: (A:) Tenascin-R

SCOPe Domain Sequences for d1tdqa1:

Sequence; same for both SEQRES and ATOM records:

>d1tdqa1 b.1.2.1 (A:3-93) Tenascin {Norway rat (Rattus norvegicus) [TaxId: 10116]}
vidgptqilvrdvsdtvafvewtpprakvdfillkyglvggeggkttfrlqpplsqysvq
alrpgsryevsisavrgtnesdasstqftte

Timeline for d1tdqa1:

• d1tdqa1 first appeared in SCOP 1.69
  
• d1tdqa1 appears in SCOPe 2.07