Lineage for d1tdpa_ (1tdp A:)

  1. Root: SCOP 1.69
  2. 436025Class a: All alpha proteins [46456] (218 folds)
  3. 442020Fold a.29: Bromodomain-like [47363] (6 superfamilies)
    4 helices; bundle; minor mirror variant of up-and-down topology
  4. 442128Superfamily a.29.8: Carnobacteriocin B2 immunity protein [109797] (1 family) (S)
  5. 442129Family a.29.8.1: Carnobacteriocin B2 immunity protein [109798] (1 protein)
  6. 442130Protein Carnobacteriocin B2 immunity protein [109799] (1 species)
  7. 442131Species Carnobacterium piscicola [TaxId:2751] [109800] (1 PDB entry)
  8. 442132Domain d1tdpa_: 1tdp A: [106781]

Details for d1tdpa_

PDB Entry: 1tdp (more details)

PDB Description: NMR solution structure of the carnobacteriocin B2 immunity protein

SCOP Domain Sequences for d1tdpa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1tdpa_ a.29.8.1 (A:) Carnobacteriocin B2 immunity protein {Carnobacterium piscicola}
mdiksqtlylnlseaykdpevkaneflsklvvqcagkltasnsensyievisllsrgiss
yylshkriipssmltiytqiqkdikngnidteklrkyeiakglmsvpyiyf

SCOP Domain Coordinates for d1tdpa_:

Click to download the PDB-style file with coordinates for d1tdpa_.
(The format of our PDB-style files is described here.)

Timeline for d1tdpa_: