Lineage for d1tdpa_ (1tdp A:)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 1992366Fold a.29: Bromodomain-like [47363] (15 superfamilies)
    4 helices; bundle; minor mirror variant of up-and-down topology
  4. 1993287Superfamily a.29.8: Bacteriocin immunity protein-like [109797] (2 families) (S)
  5. 1993288Family a.29.8.1: Carnobacteriocin B2 immunity protein [109798] (1 protein)
  6. 1993289Protein Carnobacteriocin B2 immunity protein [109799] (1 species)
  7. 1993290Species Carnobacterium piscicola [TaxId:2751] [109800] (1 PDB entry)
    Uniprot P38582
  8. 1993291Domain d1tdpa_: 1tdp A: [106781]

Details for d1tdpa_

PDB Entry: 1tdp (more details)

PDB Description: NMR solution structure of the carnobacteriocin B2 immunity protein
PDB Compounds: (A:) carnobacteriocin B2 immunity protein

SCOPe Domain Sequences for d1tdpa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1tdpa_ a.29.8.1 (A:) Carnobacteriocin B2 immunity protein {Carnobacterium piscicola [TaxId: 2751]}
mdiksqtlylnlseaykdpevkaneflsklvvqcagkltasnsensyievisllsrgiss
yylshkriipssmltiytqiqkdikngnidteklrkyeiakglmsvpyiyf

SCOPe Domain Coordinates for d1tdpa_:

Click to download the PDB-style file with coordinates for d1tdpa_.
(The format of our PDB-style files is described here.)

Timeline for d1tdpa_: