SCOP 1.71: Domain d1tdoa2: 1tdo A:320-432

Lineage for d1tdoa2 (1tdo A:320-432)

1. Root: SCOP 1.71

2. Class d: Alpha and beta proteins (a+b) [53931] (286 folds)

3. Fold d.16: FAD-linked reductases, C-terminal domain [54372] (1 superfamily)
   alpha+beta sandwich

4. Superfamily d.16.1: FAD-linked reductases, C-terminal domain [54373] (6 families)
   N-terminal domain is beta/beta/alpha common fold

5. Family d.16.1.5: L-aminoacid/polyamine oxidase [54394] (5 proteins)

6. Protein L-aminoacid oxidase [54397] (2 species)

7. Species Halys viper (Agkistrodon halys pallas) [TaxId:8714] [102800] (4 PDB entries)

8. Domain d1tdoa2: 1tdo A:320-432 [106780]
   Other proteins in same PDB: d1tdoa1
   complexed with fad, nag, phe

Details for d1tdoa2

PDB Entry: 1tdo, 3 Å

PDB Description: l-amino acid oxidae from agkistrodon halys in complex with l- phenylalanine

SCOP Domain Sequences for d1tdoa2:

Sequence; same for both SEQRES and ATOM records:

>d1tdoa2 d.16.1.5 (A:320-432) L-aminoacid oxidase {Halys viper (Agkistrodon halys pallas)}
hyrsgtkifltctkkfwedegihggksttdlpsrfiyypnhnftsgvgviiaygigddan
ffqaldfkdcadivindlslihqlpreeiqtfcypsmiqkwsldkyamggitt

Timeline for d1tdoa2:

• d1tdoa2 first appeared in SCOP 1.69
  
• d1tdoa2 appears in SCOP 1.73
  
• d1tdoa2 appears in the current release, SCOPe 2.08