Lineage for d1tdoa2 (1tdo A:320-432)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2935244Fold d.16: FAD-linked reductases, C-terminal domain [54372] (1 superfamily)
    alpha+beta sandwich
  4. 2935245Superfamily d.16.1: FAD-linked reductases, C-terminal domain [54373] (8 families) (S)
    N-terminal domain is beta/beta/alpha common fold
  5. 2935459Family d.16.1.5: L-aminoacid/polyamine oxidase [54394] (6 proteins)
  6. 2935460Protein L-aminoacid oxidase [54397] (2 species)
  7. 2935461Species Halys viper (Agkistrodon halys) [TaxId:8714] [102800] (4 PDB entries)
    Uniprot Q90W54 21-504
  8. 2935465Domain d1tdoa2: 1tdo A:320-432 [106780]
    Other proteins in same PDB: d1tdoa1
    complexed with fad, nag, phe

Details for d1tdoa2

PDB Entry: 1tdo (more details), 3 Å

PDB Description: l-amino acid oxidae from agkistrodon halys in complex with l- phenylalanine
PDB Compounds: (A:) l-amino acid oxidase

SCOPe Domain Sequences for d1tdoa2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1tdoa2 d.16.1.5 (A:320-432) L-aminoacid oxidase {Halys viper (Agkistrodon halys) [TaxId: 8714]}
hyrsgtkifltctkkfwedegihggksttdlpsrfiyypnhnftsgvgviiaygigddan
ffqaldfkdcadivindlslihqlpreeiqtfcypsmiqkwsldkyamggitt

SCOPe Domain Coordinates for d1tdoa2:

Click to download the PDB-style file with coordinates for d1tdoa2.
(The format of our PDB-style files is described here.)

Timeline for d1tdoa2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1tdoa1