Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
Fold d.16: FAD-linked reductases, C-terminal domain [54372] (1 superfamily) alpha+beta sandwich |
Superfamily d.16.1: FAD-linked reductases, C-terminal domain [54373] (8 families) N-terminal domain is beta/beta/alpha common fold |
Family d.16.1.5: L-aminoacid/polyamine oxidase [54394] (6 proteins) |
Protein L-aminoacid oxidase [54397] (2 species) |
Species Halys viper (Agkistrodon halys) [TaxId:8714] [102800] (4 PDB entries) Uniprot Q90W54 21-504 |
Domain d1tdoa2: 1tdo A:320-432 [106780] Other proteins in same PDB: d1tdoa1 complexed with fad, nag, phe |
PDB Entry: 1tdo (more details), 3 Å
SCOPe Domain Sequences for d1tdoa2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1tdoa2 d.16.1.5 (A:320-432) L-aminoacid oxidase {Halys viper (Agkistrodon halys) [TaxId: 8714]} hyrsgtkifltctkkfwedegihggksttdlpsrfiyypnhnftsgvgviiaygigddan ffqaldfkdcadivindlslihqlpreeiqtfcypsmiqkwsldkyamggitt
Timeline for d1tdoa2: