Lineage for d1tdna1 (1tdn A:3-319,A:433-486)

  1. Root: SCOP 1.73
  2. 681097Class c: Alpha and beta proteins (a/b) [51349] (141 folds)
  3. 688694Fold c.3: FAD/NAD(P)-binding domain [51904] (1 superfamily)
    core: 3 layers, b/b/a; central parallel beta-sheet of 5 strands, order 32145; top antiparallel beta-sheet of 3 strands, meander
  4. 688695Superfamily c.3.1: FAD/NAD(P)-binding domain [51905] (7 families) (S)
  5. 688749Family c.3.1.2: FAD-linked reductases, N-terminal domain [51913] (15 proteins)
    C-terminal domain is alpha+beta is common for the family
  6. 688799Protein L-aminoacid oxidase [51929] (2 species)
  7. 688800Species Halys viper (Agkistrodon halys) [TaxId:8714] [102179] (4 PDB entries)
  8. 688803Domain d1tdna1: 1tdn A:3-319,A:433-486 [106777]
    Other proteins in same PDB: d1tdna2
    complexed with fad, leu, nag

Details for d1tdna1

PDB Entry: 1tdn (more details), 2.7 Å

PDB Description: l-amino acid oxidase from agkistrodon halys in complex with l-leucine
PDB Compounds: (A:) l-amino acid oxidase

SCOP Domain Sequences for d1tdna1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1tdna1 c.3.1.2 (A:3-319,A:433-486) L-aminoacid oxidase {Halys viper (Agkistrodon halys) [TaxId: 8714]}
drnpleecfretdyeefleiarnglkatsnpkhvvvvgagmsglsaayvlsgaghqvtvl
easeraggrvrtyrndkedwyanlgpmrlpekhrivreyirkfglqlnefsqendnawyf
iknirkrvgevkkdpgvlkypvkpseegksagqlyeeslgkvveelkrtncsyilnkydt
ystkeyllkegnlspgavdmigdlmnedsgyyvsfpeslrhddifayekrfdeivggmdk
lptsmyraieekvhlnaqvikiqknaekvtvvyqtpakemasvtadyvivcttsratrri
kfepplppkkahalrsvXftpyqfqhfsesltasvdriyfagehtaeahgwidstiksgl
raardvnraseq

SCOP Domain Coordinates for d1tdna1:

Click to download the PDB-style file with coordinates for d1tdna1.
(The format of our PDB-style files is described here.)

Timeline for d1tdna1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1tdna2