SCOP 1.69: Domain d1tdka2: 1tdk A:320-432

Lineage for d1tdka2 (1tdk A:320-432)

1. Root: SCOP 1.69

2. Class d: Alpha and beta proteins (a+b) [53931] (279 folds)

3. Fold d.16: FAD-linked reductases, C-terminal domain [54372] (1 superfamily)
   alpha+beta sandwich

4. Superfamily d.16.1: FAD-linked reductases, C-terminal domain [54373] (6 families)
   N-terminal domain is beta/beta/alpha common fold

5. Family d.16.1.5: L-aminoacid/polyamine oxidase [54394] (5 proteins)

6. Protein L-aminoacid oxidase [54397] (2 species)

7. Species Halys viper (Agkistrodon halys pallas) [TaxId:8714] [102800] (4 PDB entries)

8. Domain d1tdka2: 1tdk A:320-432 [106776]
   Other proteins in same PDB: d1tdka1

Details for d1tdka2

PDB Entry: 1tdk, 2.7 Å

PDB Description: l-amino acid oxidase from agkistrodon halys in complex with suicide substrate l-vinylglycine

SCOP Domain Sequences for d1tdka2:

Sequence; same for both SEQRES and ATOM records:

>d1tdka2 d.16.1.5 (A:320-432) L-aminoacid oxidase {Halys viper (Agkistrodon halys pallas)}
hyrsgtkifltctkkfwedegihggksttdlpsrfiyypnhnftsgvgviiaygigddan
ffqaldfkdcadivindlslihqlpreeiqtfcypsmiqkwsldkyamggitt

Timeline for d1tdka2:

• d1tdka2 is new in SCOP 1.69
  
• d1tdka2 appears in SCOP 1.71
  
• d1tdka2 appears in the current release, SCOPe 2.08