Lineage for d1tdha3 (1tdh A:247-290)

  1. Root: SCOP 1.73
  2. 746751Class g: Small proteins [56992] (85 folds)
  3. 750235Fold g.39: Glucocorticoid receptor-like (DNA-binding domain) [57715] (1 superfamily)
    alpha+beta metal(zinc)-bound fold
  4. 750236Superfamily g.39.1: Glucocorticoid receptor-like (DNA-binding domain) [57716] (15 families) (S)
  5. 750541Family g.39.1.8: C-terminal, Zn-finger domain of MutM-like DNA repair proteins [81627] (3 proteins)
  6. 750577Protein Endonuclease VIII-like 1 (NEIL1) [111443] (1 species)
  7. 750578Species Human (Homo sapiens) [TaxId:9606] [111444] (1 PDB entry)
  8. 750579Domain d1tdha3: 1tdh A:247-290 [106774]
    Other proteins in same PDB: d1tdha1, d1tdha2
    complexed with tmn

Details for d1tdha3

PDB Entry: 1tdh (more details), 2.1 Å

PDB Description: Crystal structure of human endonuclease VIII-like 1 (NEIL1)
PDB Compounds: (A:) nei endonuclease VIII-like 1

SCOP Domain Sequences for d1tdha3:

Sequence; same for both SEQRES and ATOM records: (download)

>d1tdha3 g.39.1.8 (A:247-290) Endonuclease VIII-like 1 (NEIL1) {Human (Homo sapiens) [TaxId: 9606]}
esgeedfaafrawlrcygmpgmsslqdrhgrtiwfqgdpgplap

SCOP Domain Coordinates for d1tdha3:

Click to download the PDB-style file with coordinates for d1tdha3.
(The format of our PDB-style files is described here.)

Timeline for d1tdha3: